PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.J583200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 865aa    MW: 90817.6 Da    PI: 6.2407
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.J583200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox681.2e-21132187156
                        TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        +++ +++t++q++eLe++F+++++p++++r eL+k+l+L+ rqVk+WFqNrR+++k
  Pavir.J583200.1.p 132 KKRYHRHTPQQIQELEAVFKECPHPDEKQRMELSKRLNLESRQVKFWFQNRRTQMK 187
                        688999***********************************************999 PP

2START169.62.1e-533535854205
                        HHHHHHHHHHHHHC-TT-EEEE.....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEE CS
              START   4 eeaaqelvkkalaeepgWvkss.....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaet 81 
                        ++a++el+k a+ +ep+W  s+     e +n de+++ f++  +     +  ea r+ gv +  +++lv +l+d + +W+e+++    +a+t
  Pavir.J583200.1.p 353 LAAMEELMKVAQMDEPLWLPSPdggglETLNLDEYRRAFARVLGpspagYVAEATREAGVAITSSVDLVDSLMDAA-RWSEMFPcivaRAST 443
                        789************************************886669*******************************.*************** PP

                        EEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--............-TTSEE-EESSEEEEEE CS
              START  82 levissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe...........sssvvRaellpSgilie 155
                        ++ issg      g +qlm +elq+lsplvp R++vf+R+++q+ +g w++vdvSvd    p              ++++ ++llpSg++++
  Pavir.J583200.1.p 444 TDIISSGmggtrsGSIQLMHTELQVLSPLVPiREVVFLRFCKQHAEGLWAVVDVSVDAVLRPGGdphhhplngggAAGYMGCRLLPSGCVVQ 535
                        ********************************************************975443222222222578889*************** PP

                        EECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
              START 156 pksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                        ++ ng+skvtwv h++++++ +h+l+r+l++sg+a ga++w+a lqrqc+
  Pavir.J583200.1.p 536 DMNNGYSKVTWVVHAEYDEAAVHQLYRPLLRSGQALGARRWLASLQRQCQ 585
                        *************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.01E-22114189IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.1E-23119189IPR009057Homeodomain-like
PROSITE profilePS5007118.301129189IPR001356Homeobox domain
SMARTSM003898.7E-20130193IPR001356Homeobox domain
CDDcd000866.75E-20132189No hitNo description
PfamPF000464.1E-19132187IPR001356Homeobox domain
PROSITE patternPS000270164187IPR017970Homeobox, conserved site
PROSITE profilePS5084840.261341589IPR002913START domain
CDDcd088751.63E-103347585No hitNo description
SuperFamilySSF559612.12E-28348585No hitNo description
SMARTSM002344.0E-41350586IPR002913START domain
PfamPF018522.8E-45353585IPR002913START domain
SuperFamilySSF559611.18E-13676857No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 865 aa     Download sequence    Send to blast
MSFGGMFDGA AGSGVFSYDA GGGGGGGGGG GGGAGMHNHG RLIPAPPLPK PGGFGAPGLS  60
LGLQTNMDGG QLGDMSRMGL MMGGSGSGSA GEGDQLGRGR EDENDSRSGS DNVDGASGDE  120
LDPDNSNQRK KKKRYHRHTP QQIQELEAVF KECPHPDEKQ RMELSKRLNL ESRQVKFWFQ  180
NRRTQMKTQI ERHENALLRQ ENDKLRAENM TIREAMRNPI CANCGGAAVL GEVSLEEQHL  240
RIENARLKDE LDRVCALAGK FLGRPISSGS PMASSLPGCS GLELAVGSNG FGLGPLGGSA  300
LPPGLPDLMG GGLAGPVGSA GMRLPAGISA LDGGALHGAA DGVDRGVLLE LGLAAMEELM  360
KVAQMDEPLW LPSPDGGGLE TLNLDEYRRA FARVLGPSPA GYVAEATREA GVAITSSVDL  420
VDSLMDAARW SEMFPCIVAR ASTTDIISSG MGGTRSGSIQ LMHTELQVLS PLVPIREVVF  480
LRFCKQHAEG LWAVVDVSVD AVLRPGGDPH HHPLNGGGAA GYMGCRLLPS GCVVQDMNNG  540
YSKVTWVVHA EYDEAAVHQL YRPLLRSGQA LGARRWLASL QRQCQYLAIL CSNSLPSRDH  600
AAITPVGRRS MLKLAQRMTD NFCAGVCASA ALKWRRLDEW RGGEGGGGAG AAGEGEEKAR  660
MMARQSVGAP GEAPGVVLSA TTSVRLPSTP PQRVFDYLRD EQRRGEWDIL ANGEAMQEMD  720
HIAKGQHHGN AVSILRPNAT SGNQNNMLIL QETCTDSSGS LVVYAPVDVQ SMHVVMNGGD  780
SAYVSLLPSG FAILPDGHSQ PSDAAQGSPG GQSATAAGSL VTVAFQILVN NLPTAKLTVE  840
SVDTVSNLLT CTIQKIKSAL QATP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1128133RKKKKR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.180680.0leaf| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7285220.0KJ728522.1 Zea mays clone pUT6827 HB transcription factor (HB14) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004957413.10.0PREDICTED: homeobox-leucine zipper protein ROC6-like
SwissprotQ7Y0V70.0ROC6_ORYSJ; Homeobox-leucine zipper protein ROC6
TrEMBLK3ZQM80.0K3ZQM8_SETIT; Uncharacterized protein
STRINGSi028908m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP120337116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein